Lineage for d5us8b2 (5us8 B:190-442)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563173Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2563174Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2563175Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 protein domains)
  6. 2563216Protein automated matches [330535] (1 species)
    not a true protein
  7. 2563217Species Bordetella pertussis [TaxId:257313] [330536] (1 PDB entry)
  8. 2563219Domain d5us8b2: 5us8 B:190-442 [330537]
    Other proteins in same PDB: d5us8a1, d5us8a3, d5us8b1, d5us8b3
    automated match to d1k92a2
    complexed with adn, epe, pge, so4

Details for d5us8b2

PDB Entry: 5us8 (more details), 2.15 Å

PDB Description: 2.15 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis
PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d5us8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5us8b2 d.210.1.1 (B:190-442) automated matches {Bordetella pertussis [TaxId: 257313]}
aystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeevtvrfeegqpval
ngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapglallfiayerlvt
gihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvaraitgevtlelrrgnd
ysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtreklftyvktgll
apsagsalpqikd

SCOPe Domain Coordinates for d5us8b2:

Click to download the PDB-style file with coordinates for d5us8b2.
(The format of our PDB-style files is described here.)

Timeline for d5us8b2: