Lineage for d5u3id_ (5u3i D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300506Species Human (Homo sapiens) [TaxId:9606] [46501] (249 PDB entries)
    Uniprot P68871
  8. 2300845Domain d5u3id_: 5u3i D: [330271]
    Other proteins in same PDB: d5u3ia_, d5u3ic_
    automated match to d2hbsb_
    complexed with 7sj, cmo, hem

Details for d5u3id_

PDB Entry: 5u3i (more details), 1.95 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin s (liganded sickle cell hemoglobin) complexed with gbt compound 31
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d5u3id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u3id_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
hltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvk
ahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgke
ftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d5u3id_:

Click to download the PDB-style file with coordinates for d5u3id_.
(The format of our PDB-style files is described here.)

Timeline for d5u3id_: