SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u3ib_ (5u3i B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977509Species Human (Homo sapiens) [TaxId:9606] [46501] (239 PDB entries)
    Uniprot P68871
  8. 2286871Domain d5u3ib_: 5u3i B: [330172]
    Other proteins in same PDB: d5u3ia_, d5u3ic_
    automated match to d2hbsb_
    complexed with 7sj, cmo, hem

Details for d5u3ib_

PDB Entry: 5u3i (more details), 1.95 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin s (liganded sickle cell hemoglobin) complexed with gbt compound 31
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d5u3ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u3ib_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d5u3ib_:

Click to download the PDB-style file with coordinates for d5u3ib_.
(The format of our PDB-style files is described here.)

Timeline for d5u3ib_:

  • d5u3ib_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23