Lineage for d5uprd_ (5upr D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826483Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2826484Protein automated matches [190605] (25 species)
    not a true protein
  7. 2826630Species Toxoplasma gondii [TaxId:508771] [330219] (1 PDB entry)
  8. 2826634Domain d5uprd_: 5upr D: [330231]
    automated match to d1m6ja_
    complexed with cl, so4

Details for d5uprd_

PDB Entry: 5upr (more details), 2 Å

PDB Description: x-ray structure of a putative triosephosphate isomerase from toxoplasma gondii me49
PDB Compounds: (D:) triosephosphate isomerase

SCOPe Domain Sequences for d5uprd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uprd_ c.1.1.0 (D:) automated matches {Toxoplasma gondii [TaxId: 508771]}
arrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdslrqprvq
vaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvvakkvra
alneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayepvwaigt
gktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedvdgflvg
gasltgdfvsiidaak

SCOPe Domain Coordinates for d5uprd_:

Click to download the PDB-style file with coordinates for d5uprd_.
(The format of our PDB-style files is described here.)

Timeline for d5uprd_: