Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (25 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [330219] (1 PDB entry) |
Domain d5uprd_: 5upr D: [330231] automated match to d1m6ja_ complexed with cl, so4 |
PDB Entry: 5upr (more details), 2 Å
SCOPe Domain Sequences for d5uprd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uprd_ c.1.1.0 (D:) automated matches {Toxoplasma gondii [TaxId: 508771]} arrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdslrqprvq vaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvvakkvra alneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayepvwaigt gktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedvdgflvg gasltgdfvsiidaak
Timeline for d5uprd_: