SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5upra_ (5upr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2286918Species Toxoplasma gondii [TaxId:508771] [330219] (1 PDB entry)
  8. 2286919Domain d5upra_: 5upr A: [330220]
    automated match to d1m6ja_
    complexed with cl, so4

Details for d5upra_

PDB Entry: 5upr (more details), 2 Å

PDB Description: x-ray structure of a putative triosephosphate isomerase from toxoplasma gondii me49
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d5upra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5upra_ c.1.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]}
alwaarrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdslrq
prvqvaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvvak
kvraalneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayepvw
aigtgktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedvdg
flvggasltgdfvsiidaakqqa

SCOPe Domain Coordinates for d5upra_:

Click to download the PDB-style file with coordinates for d5upra_.
(The format of our PDB-style files is described here.)

Timeline for d5upra_:

  • d5upra_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23