Lineage for d1gsda2 (1gsd A:2-80)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992326Protein Class alpha GST [81360] (8 species)
  7. 992346Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (19 PDB entries)
    Uniprot P08263
  8. 992369Domain d1gsda2: 1gsd A:2-80 [32963]
    Other proteins in same PDB: d1gsda1, d1gsdb1, d1gsdc1, d1gsdd1

Details for d1gsda2

PDB Entry: 1gsd (more details), 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form
PDB Compounds: (A:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsda2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d1gsda2:

Click to download the PDB-style file with coordinates for d1gsda2.
(The format of our PDB-style files is described here.)

Timeline for d1gsda2: