Lineage for d1gsdd1 (1gsd D:81-209)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915620Protein Class alpha GST [81349] (8 species)
  7. 915640Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (19 PDB entries)
    Uniprot P08263
  8. 915666Domain d1gsdd1: 1gsd D:81-209 [118476]
    Other proteins in same PDB: d1gsda2, d1gsdb2, d1gsdc2, d1gsdd2
    duplicate of 1GSD A:81-209

Details for d1gsdd1

PDB Entry: 1gsd (more details), 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form
PDB Compounds: (D:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsdd1 a.45.1.1 (D:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

SCOPe Domain Coordinates for d1gsdd1:

Click to download the PDB-style file with coordinates for d1gsdd1.
(The format of our PDB-style files is described here.)

Timeline for d1gsdd1: