SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kejb2 (5kej B:85-223)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 2285879Species Mangifera indica [TaxId:29780] [329180] (3 PDB entries)
  8. 2285944Domain d5kejb2: 5kej B:85-223 [329245]
    Other proteins in same PDB: d5keja1, d5kejb1
    automated match to d5agya2
    complexed with gtx, peg

Details for d5kejb2

PDB Entry: 5kej (more details), 2.35 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione
PDB Compounds: (B:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5kejb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kejb2 a.45.1.0 (B:85-223) automated matches {Mangifera indica [TaxId: 29780]}
ilpsdpydraiarfwaayldekwypslkgiasaqgeeakkaavdqvgeslaliedtyvkl
skgkpffggekigyldiafgcflgwlrvtektsgvkflneaktphlakwavrfcadpavk
dvmpeteklaefakllakf

SCOPe Domain Coordinates for d5kejb2:

Click to download the PDB-style file with coordinates for d5kejb2.
(The format of our PDB-style files is described here.)

Timeline for d5kejb2:

  • d5kejb2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5kejb1