Lineage for d5kejb1 (5kej B:2-84)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (164 species)
    not a true protein
  7. 2285877Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries)
  8. 2285943Domain d5kejb1: 5kej B:2-84 [329244]
    Other proteins in same PDB: d5keja2, d5kejb2
    automated match to d5agya1
    complexed with gtx, peg

Details for d5kejb1

PDB Entry: 5kej (more details), 2.35 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione
PDB Compounds: (B:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5kejb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kejb1 c.47.1.0 (B:2-84) automated matches {Mangifera indica [TaxId: 29780]}
aksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihn
dkpicesliivhyidefwssgps

SCOPe Domain Coordinates for d5kejb1:

Click to download the PDB-style file with coordinates for d5kejb1.
(The format of our PDB-style files is described here.)

Timeline for d5kejb1:

  • d5kejb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5kejb2