SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5keja1 (5kej A:2-84)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (160 species)
    not a true protein
  7. 2285877Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries)
  8. 2285976Domain d5keja1: 5kej A:2-84 [329277]
    Other proteins in same PDB: d5keja2, d5kejb2
    automated match to d5agya1
    complexed with gtx, peg

Details for d5keja1

PDB Entry: 5kej (more details), 2.35 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione
PDB Compounds: (A:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5keja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5keja1 c.47.1.0 (A:2-84) automated matches {Mangifera indica [TaxId: 29780]}
aksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihn
dkpicesliivhyidefwssgps

SCOPe Domain Coordinates for d5keja1:

Click to download the PDB-style file with coordinates for d5keja1.
(The format of our PDB-style files is described here.)

Timeline for d5keja1:

  • d5keja1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5keja2