Lineage for d5k35b1 (5k35 B:2-69)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2169177Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2169178Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2169402Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2169403Protein automated matches [190710] (3 species)
    not a true protein
  7. 2169404Species Human (Homo sapiens) [TaxId:9606] [187857] (38 PDB entries)
  8. 2285636Domain d5k35b1: 5k35 B:2-69 [328937]
    Other proteins in same PDB: d5k35b2
    automated match to d3wsob1

Details for d5k35b1

PDB Entry: 5k35 (more details), 2.85 Å

PDB Description: structure of the legionella effector, ankb, in complex with human skp1
PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5k35b1:

Sequence, based on SEQRES records: (download)

>d5k35b1 d.42.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthhkddp

Sequence, based on observed residues (ATOM records): (download)

>d5k35b1 d.42.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdddpvplpnvnaailkkviqwcthh
kddp

SCOPe Domain Coordinates for d5k35b1:

Click to download the PDB-style file with coordinates for d5k35b1.
(The format of our PDB-style files is described here.)

Timeline for d5k35b1:

  • d5k35b1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26