SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k35b2 (5k35 B:79-160)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013779Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2013780Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2013781Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 protein domains)
  6. 2013808Protein automated matches [226933] (1 species)
    not a true protein
  7. 2013809Species Human (Homo sapiens) [TaxId:9606] [225235] (6 PDB entries)
  8. 2285637Domain d5k35b2: 5k35 B:79-160 [328938]
    Other proteins in same PDB: d5k35b1
    automated match to d3wsob2

Details for d5k35b2

PDB Entry: 5k35 (more details), 2.85 Å

PDB Description: structure of the legionella effector, ankb, in complex with human skp1
PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5k35b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k35b2 a.157.1.1 (B:79-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndfteeeeaqvrkenqwc

SCOPe Domain Coordinates for d5k35b2:

Click to download the PDB-style file with coordinates for d5k35b2.
(The format of our PDB-style files is described here.)

Timeline for d5k35b2:

  • d5k35b2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26