SCOPe 2.07: Domain d5k35b1: 5k35 B:2-69

Lineage for d5k35b1 (5k35 B:2-69)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)

8. Domain d5k35b1: 5k35 B:2-69 [328937]
   Other proteins in same PDB: d5k35b2
   automated match to d3wsob1

Details for d5k35b1

PDB Entry: 5k35, 2.85 Å

PDB Description: structure of the legionella effector, ankb, in complex with human skp1

PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5k35b1:

Sequence, based on SEQRES records:

>d5k35b1 d.42.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthhkddp

Sequence, based on observed residues (ATOM records):

>d5k35b1 d.42.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdddpvplpnvnaailkkviqwcthh
kddp

Timeline for d5k35b1:

• d5k35b1 first appeared in SCOPe 2.06
  
• d5k35b1 appears in the current release, SCOPe 2.08