Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries) |
Domain d5k35b1: 5k35 B:2-69 [328937] Other proteins in same PDB: d5k35b2 automated match to d3wsob1 |
PDB Entry: 5k35 (more details), 2.85 Å
SCOPe Domain Sequences for d5k35b1:
Sequence, based on SEQRES records: (download)
>d5k35b1 d.42.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw cthhkddp
>d5k35b1 d.42.1.0 (B:2-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} psiklqssdgeifevdveiakqsvtiktmledlgmdddpvplpnvnaailkkviqwcthh kddp
Timeline for d5k35b1: