Lineage for d5ed6b_ (5ed6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929713Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2929812Protein automated matches [191082] (3 species)
    not a true protein
  7. 2929818Species Human (Homo sapiens) [TaxId:9606] [189791] (32 PDB entries)
  8. 2929866Domain d5ed6b_: 5ed6 B: [328930]
    automated match to d3tw2a_
    complexed with amp, epe; mutant

Details for d5ed6b_

PDB Entry: 5ed6 (more details), 1.52 Å

PDB Description: crystal structure of human hint1 h114a mutant complexing with atp
PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5ed6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ed6b_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde
sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlavlggrqmhwppg

SCOPe Domain Coordinates for d5ed6b_:

Click to download the PDB-style file with coordinates for d5ed6b_.
(The format of our PDB-style files is described here.)

Timeline for d5ed6b_: