SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ed6b_ (5ed6 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157130Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2157196Protein automated matches [191082] (2 species)
    not a true protein
  7. 2157202Species Human (Homo sapiens) [TaxId:9606] [189791] (14 PDB entries)
  8. 2285629Domain d5ed6b_: 5ed6 B: [328930]
    automated match to d3tw2a_
    complexed with amp, epe; mutant

Details for d5ed6b_

PDB Entry: 5ed6 (more details), 1.52 Å

PDB Description: crystal structure of human hint1 h114a mutant complexing with atp
PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5ed6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ed6b_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde
sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlavlggrqmhwppg

SCOPe Domain Coordinates for d5ed6b_:

Click to download the PDB-style file with coordinates for d5ed6b_.
(The format of our PDB-style files is described here.)

Timeline for d5ed6b_:

  • d5ed6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26