Lineage for d3tw2a_ (3tw2 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.13: HIT-like [54196] (2 superfamilies)
alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alphaSuperfamily d.13.1: HIT-like [54197] (6 families) 
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
Pfam PF01230
topologically similar to the N-terminal domain of protein kinases
Protein automated matches [191082] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189791] (32 PDB entries) 
Domain d3tw2a_: 3tw2 A: [185969]
automated match to d1av5a_
complexed with amp
Details for d3tw2a_
PDB Entry: 3tw2 (more details), 1.38 Å
PDB Description: High resolution structure of human histidine triad nucleotide-binding protein 1 (hHINT1)/AMP complex in a monoclinic space group
PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1SCOPe Domain Sequences for d3tw2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tw2a_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddd
esllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
SCOPe Domain Coordinates for d3tw2a_:
Click to download the PDB-style file with coordinates for d3tw2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tw2a_:
- d3tw2a_ first appeared in SCOPe 2.01
- d3tw2a_ appears in SCOPe 2.07
View in 3D
