Lineage for d5m1bb2 (5m1b B:326-490)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242922Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other
  4. 2242923Superfamily d.333.1: UbiD C-terminal domain-like [143968] (2 families) (S)
  5. 2242930Family d.333.1.0: automated matches [328000] (1 protein)
    not a true family
  6. 2242931Protein automated matches [328001] (2 species)
    not a true protein
  7. 2242932Species Escherichia coli [TaxId:199310] [328006] (3 PDB entries)
  8. 2242940Domain d5m1bb2: 5m1b B:326-490 [328129]
    Other proteins in same PDB: d5m1ba1, d5m1bb1, d5m1bc1
    automated match to d2idba2

Details for d5m1bb2

PDB Entry: 5m1b (more details), 3.15 Å

PDB Description: crystal structure of c-terminally tagged apo-ubid from e. coli
PDB Compounds: (B:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m1bb2 d.333.1.0 (B:326-490) automated matches {Escherichia coli [TaxId: 199310]}
pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv
wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs
glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelai

SCOPe Domain Coordinates for d5m1bb2:

Click to download the PDB-style file with coordinates for d5m1bb2.
(The format of our PDB-style files is described here.)

Timeline for d5m1bb2: