![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily) alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other |
![]() | Superfamily d.333.1: UbiD C-terminal domain-like [143968] (2 families) ![]() |
![]() | Family d.333.1.0: automated matches [328000] (1 protein) not a true family |
![]() | Protein automated matches [328001] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:199310] [328006] (3 PDB entries) |
![]() | Domain d5m1bb2: 5m1b B:326-490 [328129] Other proteins in same PDB: d5m1ba1, d5m1bb1, d5m1bc1 automated match to d2idba2 |
PDB Entry: 5m1b (more details), 3.15 Å
SCOPe Domain Sequences for d5m1bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m1bb2 d.333.1.0 (B:326-490) automated matches {Escherichia coli [TaxId: 199310]} pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelai
Timeline for d5m1bb2:
![]() Domains from other chains: (mouse over for more information) d5m1ba1, d5m1ba2, d5m1bc1, d5m1bc2 |