SCOPe 2.08: Domain d5kx5d1: 5kx5 D:2-245

Lineage for d5kx5d1 (5kx5 D:2-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)

8. Domain d5kx5d1: 5kx5 D:2-245 [327638]
   Other proteins in same PDB: d5kx5b2, d5kx5c2, d5kx5d2, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3
   automated match to d4drxb1
   complexed with 6yk, adp, ca, gdp, gtp, mg

Details for d5kx5d1

PDB Entry: 5kx5, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5kx5d1:

Sequence; same for both SEQRES and ATOM records:

>d5kx5d1 c.32.1.1 (D:2-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d5kx5d1:

• d5kx5d1 first appeared in SCOPe 2.06
  
• d5kx5d1 appears in SCOPe 2.07