SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kx5c2 (5kx5 C:246-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180671Species Sheep (Ovis aries) [TaxId:9940] [226224] (12 PDB entries)
  8. 2284347Domain d5kx5c2: 5kx5 C:246-440 [327648]
    Other proteins in same PDB: d5kx5b1, d5kx5c1, d5kx5d1, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3
    automated match to d4i50a2
    complexed with 6yk, adp, ca, gdp, gtp, mg

Details for d5kx5c2

PDB Entry: 5kx5 (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d5kx5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kx5c2 d.79.2.1 (C:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5kx5c2:

Click to download the PDB-style file with coordinates for d5kx5c2.
(The format of our PDB-style files is described here.)

Timeline for d5kx5c2:

  • d5kx5c2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29