SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kx5f2 (5kx5 F:77-378)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195211Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 protein domains)
    Pfam PF03133; PubMed 22020298
  6. 2195212Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2195213Species Chicken (Gallus gallus) [TaxId:9031] [311385] (25 PDB entries)
  8. 2284354Domain d5kx5f2: 5kx5 F:77-378 [327655]
    Other proteins in same PDB: d5kx5b1, d5kx5b2, d5kx5c1, d5kx5c2, d5kx5d1, d5kx5d2, d5kx5e_, d5kx5f1, d5kx5f3
    automated match to d3tiia2
    complexed with 6yk, adp, ca, gdp, gtp, mg

Details for d5kx5f2

PDB Entry: 5kx5 (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex
PDB Compounds: (F:) Ttl protein

SCOPe Domain Sequences for d5kx5f2:

Sequence, based on SEQRES records: (download)

>d5kx5f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5kx5f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwiakssilisse
aselldfidevhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepy
nsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttlensillqik
hiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcq
givdvaissvfplasifikl

SCOPe Domain Coordinates for d5kx5f2:

Click to download the PDB-style file with coordinates for d5kx5f2.
(The format of our PDB-style files is described here.)

Timeline for d5kx5f2:

  • d5kx5f2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29