SCOPe 2.08: Domain d5h4za_: 5h4z A:

Lineage for d5h4za_ (5h4z A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)

8. Domain d5h4za_: 5h4z A: [326674]
   automated match to d1w15a_
   complexed with ca, cl; mutant

Details for d5h4za_

PDB Entry: 5h4z, 3.01 Å

PDB Description: crystal structure of s202g mutant of human syt-5 c2a domain

PDB Compounds: (A:) Synaptotagmin-5

SCOPe Domain Sequences for d5h4za_:

Sequence; same for both SEQRES and ATOM records:

>d5h4za_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkhelgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyllpdkrrryetkv
hrqtlnphfgetfafkvpyvelggrvlvmavydfdrfgrndaigevrvpmssvdlgrpvq
awrelqaap

Timeline for d5h4za_:

• d5h4za_ first appeared in SCOPe 2.06
  
• d5h4za_ appears in SCOPe 2.07