SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h4zb_ (5h4z B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038265Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2038266Protein automated matches [190497] (4 species)
    not a true protein
  7. 2038269Species Human (Homo sapiens) [TaxId:9606] [188711] (22 PDB entries)
  8. 2283391Domain d5h4zb_: 5h4z B: [326692]
    automated match to d1w15a_
    complexed with ca, cl; mutant

Details for d5h4zb_

PDB Entry: 5h4z (more details), 3.01 Å

PDB Description: crystal structure of s202g mutant of human syt-5 c2a domain
PDB Compounds: (B:) Synaptotagmin-5

SCOPe Domain Sequences for d5h4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4zb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khelgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyllpdkrrryetkvh
rqtlnphfgetfafkvpyvelggrvlvmavydfdrfgrndaigevrvpmssvdlgrpvqa
wrelqaap

SCOPe Domain Coordinates for d5h4zb_:

Click to download the PDB-style file with coordinates for d5h4zb_.
(The format of our PDB-style files is described here.)

Timeline for d5h4zb_:

  • d5h4zb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-30