SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ewta_ (5ewt A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200942Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2200943Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2201053Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2201054Protein automated matches [190734] (12 species)
    not a true protein
  7. 2283128Species Sulfolobus islandicus [TaxId:930945] [326429] (1 PDB entry)
  8. 2283129Domain d5ewta_: 5ewt A: [326430]
    automated match to d3g3ca_

Details for d5ewta_

PDB Entry: 5ewt (more details), 1.8 Å

PDB Description: crystal structure of exoiii endonuclease from sulfolobus islandicus
PDB Compounds: (A:) Exodeoxyribonuclease III Xth

SCOPe Domain Sequences for d5ewta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ewta_ d.151.1.0 (A:) automated matches {Sulfolobus islandicus [TaxId: 930945]}
mkivswnvngiraalkknlidfiennmfevimfqetkgdivpldfimmgyevisfpakrk
gysgvmtltkikpinvikglqikefddegrtvtlelkdfyvinaafpragdnlerldfkl
kfnneienfvlklrrakpvilcgdfniahqnidgafsdptipgltpqerswfshflslgf
idtfrylhpnvrkyswwsymgkareknlglrldycivseelkdrikmadilidiqgsdha
piilelt

SCOPe Domain Coordinates for d5ewta_:

Click to download the PDB-style file with coordinates for d5ewta_.
(The format of our PDB-style files is described here.)

Timeline for d5ewta_:

  • d5ewta_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23