PDB entry 5ewt

View 5ewt on RCSB PDB site
Description: Crystal structure of ExoIII endonuclease from Sulfolobus islandicus
Class: hydrolase
Keywords: AP endonuclease, Disulfide bond, Hyperthermophilic, HYDROLASE
Deposited on 2015-11-21, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exodeoxyribonuclease III Xth
    Species: Sulfolobus islandicus REY15A [TaxId:930945]
    Gene: SiRe_0100
    Database cross-references and differences (RAF-indexed):
    • Uniprot F0NG49 (0-246)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d5ewta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ewtA (A:)
    mkivswnvngiraalkknlidfiennmfevimfqetkgdivpldfimmgyevisfpakrk
    gysgvmtltkikpinvikglqikefddegrtvtlelkdfyvinaafpragdnlerldfkl
    kfnneienfvlklrrakpvilcgdfniahqnidgafsdptipgltpqerswfshflslgf
    idtfrylhpnvrkyswwsymgkareknlglrldycivseelkdrikmadilidiqgsdha
    piilelt