Lineage for d5te7l1 (5te7 L:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755345Domain d5te7l1: 5te7 L:1-106 [326330]
    Other proteins in same PDB: d5te7l2
    automated match to d1dn0a1
    complexed with edo, epe, nag

Details for d5te7l1

PDB Entry: 5te7 (more details), 2.15 Å

PDB Description: crystal structure of broadly neutralizing vrc01-class antibody n6 in complex with hiv-1 clade c strain du172.17 gp120 core
PDB Compounds: (L:) Light chain of N6

SCOPe Domain Sequences for d5te7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5te7l1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yihvtqspsslsvsigdrvtincqtsqgvgsdlhwyqhkpgrapkllihhtssvedgvps
rfsgsgfhtsfnltisdlqaddiatyycqvlqffgrgsrlhi

SCOPe Domain Coordinates for d5te7l1:

Click to download the PDB-style file with coordinates for d5te7l1.
(The format of our PDB-style files is described here.)

Timeline for d5te7l1: