Lineage for d5ehdh_ (5ehd H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821688Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 2821689Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
    automatically mapped to Pfam PF03066
  6. 2821726Protein automated matches [190762] (3 species)
    not a true protein
  7. 2821738Species Human (Homo sapiens) [TaxId:9606] [187973] (2 PDB entries)
  8. 2821756Domain d5ehdh_: 5ehd H: [325340]
    automated match to d4n8ma_
    complexed with cl

Details for d5ehdh_

PDB Entry: 5ehd (more details), 2.55 Å

PDB Description: crystal structure of human nucleophosmin-core in complex with cytochrome c
PDB Compounds: (H:) Nucleophosmin

SCOPe Domain Sequences for d5ehdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ehdh_ b.121.3.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpqnylfgcelkadkdyhfkvdndenehqlslrtvslgagakdelhiveaeamnyegspi
kvtlatlkmsvqptvslggfeitppvvlrlkcgsgpvhisgqhlvav

SCOPe Domain Coordinates for d5ehdh_:

Click to download the PDB-style file with coordinates for d5ehdh_.
(The format of our PDB-style files is described here.)

Timeline for d5ehdh_: