Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) oligomerizes into a pentameric ring structure |
Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins) automatically mapped to Pfam PF03066 |
Protein automated matches [190762] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187973] (2 PDB entries) |
Domain d5ehdg_: 5ehd G: [324862] automated match to d4n8ma_ complexed with cl |
PDB Entry: 5ehd (more details), 2.55 Å
SCOPe Domain Sequences for d5ehdg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ehdg_ b.121.3.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pqnylfgcelkadkdyhfkvdndenehqlslrtvslgagakdelhiveaeamnyegspik vtlatlkmsvqptvslggfeitppvvlrlkcgsgpvhisgqhlvav
Timeline for d5ehdg_: