Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries) |
Domain d5fctb_: 5fct B: [324397] automated match to d4eb4a_ complexed with c2f, ufp |
PDB Entry: 5fct (more details), 1.55 Å
SCOPe Domain Sequences for d5fctb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fctb_ d.117.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav
Timeline for d5fctb_: