Lineage for d5b6qa_ (5b6q A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691745Species Shewanella violacea [TaxId:60217] [324148] (2 PDB entries)
  8. 2691748Domain d5b6qa_: 5b6q A: [324305]
    automated match to d1cc5a_
    complexed with hec, imd

Details for d5b6qa_

PDB Entry: 5b6q (more details), 1.78 Å

PDB Description: crystal structure of monomeric cytochrome c5 from shewanella violacea
PDB Compounds: (A:) Soluble cytochrome cA

SCOPe Domain Sequences for d5b6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6qa_ a.3.1.0 (A:) automated matches {Shewanella violacea [TaxId: 60217]}
qegkavydkachichsmgvagapkahdaaawepriaqgldtlvstvktgkgamppggmct
dctdedyksaieymsk

SCOPe Domain Coordinates for d5b6qa_:

Click to download the PDB-style file with coordinates for d5b6qa_.
(The format of our PDB-style files is described here.)

Timeline for d5b6qa_: