SCOPe 2.07: Domain d5b6qa_: 5b6q A:

Lineage for d5b6qa_ (5b6q A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (25 species)
   not a true protein

7. Species Shewanella violacea [TaxId:60217] [324148] (2 PDB entries)

8. Domain d5b6qa_: 5b6q A: [324305]
   automated match to d1cc5a_
   complexed with hem, imd

Details for d5b6qa_

PDB Entry: 5b6q, 1.78 Å

PDB Description: crystal structure of monomeric cytochrome c5 from shewanella violacea

PDB Compounds: (A:) Soluble cytochrome cA

SCOPe Domain Sequences for d5b6qa_:

Sequence; same for both SEQRES and ATOM records:

>d5b6qa_ a.3.1.0 (A:) automated matches {Shewanella violacea [TaxId: 60217]}
qegkavydkachichsmgvagapkahdaaawepriaqgldtlvstvktgkgamppggmct
dctdedyksaieymsk

Timeline for d5b6qa_:

• d5b6qa_ first appeared in SCOPe 2.06
  
• d5b6qa_ appears in the current release, SCOPe 2.08