SCOPe 2.07: Domain d5an1g1: 5an1 G:2-85

Lineage for d5an1g1 (5an1 G:2-85)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [323880] (1 PDB entry)

8. Domain d5an1g1: 5an1 G:2-85 [323881]
   Other proteins in same PDB: d5an1a2, d5an1b2, d5an1c2, d5an1d2, d5an1e2, d5an1f2, d5an1g2, d5an1h2
   automated match to d3crta1
   complexed with gsh

Details for d5an1g1

PDB Entry: 5an1, 2 Å

PDB Description: crystallographic structure of the glutathione s-transferase from litopenaeus vannamei complexed with glutathione

PDB Compounds: (G:) glutathione s-transferase

SCOPe Domain Sequences for d5an1g1:

Sequence; same for both SEQRES and ATOM records:

>d5an1g1 c.47.1.0 (G:2-85) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
lpvlgywktralcqpirlmlgytgtefeeknypvgdapdydksewlavkfklglafpnlp
yyidgdvkitqskaimrylarkhg

Timeline for d5an1g1:

• d5an1g1 first appeared in SCOPe 2.06
  
• d5an1g1 appears in the current release, SCOPe 2.08