Lineage for d5an1h2 (5an1 H:86-219)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327292Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [323882] (1 PDB entry)
  8. 2327300Domain d5an1h2: 5an1 H:86-219 [323990]
    Other proteins in same PDB: d5an1a1, d5an1b1, d5an1c1, d5an1d1, d5an1e1, d5an1f1, d5an1g1, d5an1h1
    automated match to d3crta2
    complexed with gsh

Details for d5an1h2

PDB Entry: 5an1 (more details), 2 Å

PDB Description: crystallographic structure of the glutathione s-transferase from litopenaeus vannamei complexed with glutathione
PDB Compounds: (H:) glutathione s-transferase

SCOPe Domain Sequences for d5an1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5an1h2 a.45.1.0 (H:86-219) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
lcgttpeelvrtdmiecqltdmheafftvtyehyeqkdaytaslpaklrqysdflgsrpw
fagdkltyidflayeifdqhlsldrtcldgfknlqafqkrfedleaikkymaspkflkkp
icnkyaqftiiegk

SCOPe Domain Coordinates for d5an1h2:

Click to download the PDB-style file with coordinates for d5an1h2.
(The format of our PDB-style files is described here.)

Timeline for d5an1h2: