SCOPe 2.08: Domain d5an1h2: 5an1 H:86-219

Lineage for d5an1h2 (5an1 H:86-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [323882] (1 PDB entry)

8. Domain d5an1h2: 5an1 H:86-219 [323990]
   Other proteins in same PDB: d5an1a1, d5an1b1, d5an1c1, d5an1d1, d5an1e1, d5an1f1, d5an1g1, d5an1h1
   automated match to d3crta2
   complexed with gsh

Details for d5an1h2

PDB Entry: 5an1, 2 Å

PDB Description: crystallographic structure of the glutathione s-transferase from litopenaeus vannamei complexed with glutathione

PDB Compounds: (H:) glutathione s-transferase

SCOPe Domain Sequences for d5an1h2:

Sequence; same for both SEQRES and ATOM records:

>d5an1h2 a.45.1.0 (H:86-219) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
lcgttpeelvrtdmiecqltdmheafftvtyehyeqkdaytaslpaklrqysdflgsrpw
fagdkltyidflayeifdqhlsldrtcldgfknlqafqkrfedleaikkymaspkflkkp
icnkyaqftiiegk

Timeline for d5an1h2:

• d5an1h2 first appeared in SCOPe 2.06
  
• d5an1h2 appears in SCOPe 2.07