Lineage for d3crta1 (3crt A:1-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484540Protein Class alpha GST [81360] (8 species)
  7. 2484683Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
    Uniprot P08515
  8. 2484687Domain d3crta1: 3crt A:1-80 [208935]
    Other proteins in same PDB: d3crta2
    automated match to d1m9aa2
    complexed with gsh

Details for d3crta1

PDB Entry: 3crt (more details), 1.9 Å

PDB Description: structural characterization of an engineered allosteric protein
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d3crta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crta1 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelgcefpnlpyyid
gdvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d3crta1:

Click to download the PDB-style file with coordinates for d3crta1.
(The format of our PDB-style files is described here.)

Timeline for d3crta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3crta2