Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Litopenaeus vannamei [TaxId:6689] [323880] (1 PDB entry) |
Domain d5an1g1: 5an1 G:2-85 [323881] Other proteins in same PDB: d5an1a2, d5an1b2, d5an1c2, d5an1d2, d5an1e2, d5an1f2, d5an1g2, d5an1h2 automated match to d3crta1 complexed with gsh |
PDB Entry: 5an1 (more details), 2 Å
SCOPe Domain Sequences for d5an1g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5an1g1 c.47.1.0 (G:2-85) automated matches {Litopenaeus vannamei [TaxId: 6689]} lpvlgywktralcqpirlmlgytgtefeeknypvgdapdydksewlavkfklglafpnlp yyidgdvkitqskaimrylarkhg
Timeline for d5an1g1: