Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Paraburkholderia phymatum [TaxId:391038] [323794] (1 PDB entry) |
Domain d5te9a_: 5te9 A: [323795] automated match to d1jlkb_ |
PDB Entry: 5te9 (more details), 2.4 Å
SCOPe Domain Sequences for d5te9a_:
Sequence, based on SEQRES records: (download)
>d5te9a_ c.23.1.0 (A:) automated matches {Paraburkholderia phymatum [TaxId: 391038]} dlihillvedsptdvmitreafdyykllnplhvagdgvaameflrregqhsdaprpglii ldlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartyglhancyitkpvdftr fvevvrrisdfwfgvvtlp
>d5te9a_ c.23.1.0 (A:) automated matches {Paraburkholderia phymatum [TaxId: 391038]} dlihillvedsptdvmitreafdyykllnplhvagdgvaameflrregqhsdaprpglii ldlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartygancyitkpvdftrfv evvrrisdfwfgvvtlp
Timeline for d5te9a_: