SCOPe 2.08: Domain d5te9a_: 5te9 A:

Lineage for d5te9a_ (5te9 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Paraburkholderia phymatum [TaxId:391038] [323794] (1 PDB entry)

8. Domain d5te9a_: 5te9 A: [323795]
   automated match to d1jlkb_

Details for d5te9a_

PDB Entry: 5te9, 2.4 Å

PDB Description: crystal structure of a response regulator receiver protein from burkholderia phymatum

PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d5te9a_:

Sequence, based on SEQRES records:

>d5te9a_ c.23.1.0 (A:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
dlihillvedsptdvmitreafdyykllnplhvagdgvaameflrregqhsdaprpglii
ldlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartyglhancyitkpvdftr
fvevvrrisdfwfgvvtlp

Sequence, based on observed residues (ATOM records):

>d5te9a_ c.23.1.0 (A:) automated matches {Paraburkholderia phymatum [TaxId: 391038]}
dlihillvedsptdvmitreafdyykllnplhvagdgvaameflrregqhsdaprpglii
ldlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartygancyitkpvdftrfv
evvrrisdfwfgvvtlp

Timeline for d5te9a_:

• d5te9a_ first appeared in SCOPe 2.06
  
• d5te9a_ appears in SCOPe 2.07