PDB entry 5te9

View 5te9 on RCSB PDB site
Description: Crystal structure of a response regulator receiver protein from Burkholderia phymatum
Class: signaling protein
Keywords: structural genomics, SSGCID, NIAID, proteobacteria, Seattle Structural Genomics Center for Infectious Disease, SIGNALING PROTEIN
Deposited on 2016-09-20, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: Bphy_1144
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5te9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5te9A (A:)
    mahhhhhhmptqavddlihillvedsptdvmitreafdyykllnplhvagdgvaameflr
    regqhsdaprpgliildlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartyg
    lhancyitkpvdftrfvevvrrisdfwfgvvtlppars
    

    Sequence, based on observed residues (ATOM records): (download)
    >5te9A (A:)
    dlihillvedsptdvmitreafdyykllnplhvagdgvaameflrregqhsdaprpglii
    ldlnlpkksgrevlqelkadpdlmkipvvvlttskseedvartygancyitkpvdftrfv
    evvrrisdfwfgvvtlp