SCOPe 2.08: Domain d5chwj2: 5chw J:77-150

Lineage for d5chwj2 (5chw J:77-150)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)

8. Domain d5chwj2: 5chw J:77-150 [323385]
   automated match to d3pseb2
   complexed with gol, so4

Details for d5chwj2

PDB Entry: 5chw, 2.1 Å

PDB Description: structure of isg15 in space group p212121

PDB Compounds: (J:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5chwj2:

Sequence; same for both SEQRES and ATOM records:

>d5chwj2 d.15.1.0 (J:77-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seplsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellg
eyglkpqctvikhl

Timeline for d5chwj2:

• d5chwj2 first appeared in SCOPe 2.06
  
• d5chwj2 appears in SCOPe 2.07