Lineage for d5b1al_ (5b1a L:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578374Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 2578375Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 2578376Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2578377Species Cow (Bos taurus) [TaxId:9913] [81424] (42 PDB entries)
  8. 2578386Domain d5b1al_: 5b1a L: [322850]
    Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1as_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1az_
    automated match to d1v54l_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d5b1al_

PDB Entry: 5b1a (more details), 1.5 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
PDB Compounds: (L:) cytochrome c oxidase subunit 7c, mitochondrial

SCOPe Domain Sequences for d5b1al_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1al_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d5b1al_:

Click to download the PDB-style file with coordinates for d5b1al_.
(The format of our PDB-style files is described here.)

Timeline for d5b1al_: