![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
![]() | Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries) |
![]() | Domain d5b1as_: 5b1a S: [322679] Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_ automated match to d1v54f_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 5b1a (more details), 1.5 Å
SCOPe Domain Sequences for d5b1as_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1as_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d5b1as_:
![]() Domains from other chains: (mouse over for more information) d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_ |