![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (56 PDB entries) |
![]() | Domain d5b1ap_: 5b1a P: [322557] Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1aq_, d5b1ar_, d5b1as_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_ automated match to d1v54c_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 5b1a (more details), 1.5 Å
SCOPe Domain Sequences for d5b1ap_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1ap_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d5b1ap_:
![]() Domains from other chains: (mouse over for more information) d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1aq_, d5b1ar_, d5b1as_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_ |