Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
Domain d5b83a1: 5b83 A:1-76 [322145] automated match to d2k39a_ |
PDB Entry: 5b83 (more details), 2.69 Å
SCOPe Domain Sequences for d5b83a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b83a1 d.15.1.0 (A:1-76) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d5b83a1:
View in 3D Domains from other chains: (mouse over for more information) d5b83d1, d5b83d2, d5b83d3, d5b83d4 |