Lineage for d5lexy_ (5lex Y:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2228267Species Human (Homo sapiens) [TaxId:9606] [311421] (8 PDB entries)
  8. 2228296Domain d5lexy_: 5lex Y: [321552]
    Other proteins in same PDB: d5lexa_, d5lexb_, d5lexc_, d5lexd_, d5lexe_, d5lexf_, d5lexg_, d5lexh_, d5lexi_, d5lexj_, d5lexm_, d5lexo_, d5lexp_, d5lexq_, d5lexr_, d5lexs_, d5lext_, d5lexu_, d5lexv_, d5lexw_, d5lexx_
    automated match to d1irul_
    complexed with 1pe, k, mg

Details for d5lexy_

PDB Entry: 5lex (more details), 2.2 Å

PDB Description: native human 20s proteasome in mg-acetate at 2.2 angstrom
PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d5lexy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lexy_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]}
tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
edgwirvssdnvadlheky

SCOPe Domain Coordinates for d5lexy_:

Click to download the PDB-style file with coordinates for d5lexy_.
(The format of our PDB-style files is described here.)

Timeline for d5lexy_: