Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species) contains an extension to the common fold at the N-terminus |
Species Human (Homo sapiens) [TaxId:9606] [311422] (8 PDB entries) |
Domain d5lexa_: 5lex A: [321486] Other proteins in same PDB: d5lexd_, d5lexe_, d5lexf_, d5lexg_, d5lexh_, d5lexi_, d5lexj_, d5lexk_, d5lexl_, d5lexm_, d5lexn_, d5lexr_, d5lexs_, d5lext_, d5lexu_, d5lexv_, d5lexw_, d5lexx_, d5lexy_, d5lexz_ automated match to d1irub_ complexed with 1pe, k, mg |
PDB Entry: 5lex (more details), 2.2 Å
SCOPe Domain Sequences for d5lexa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lexa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai
Timeline for d5lexa_: