Lineage for d5lexw_ (5lex W:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230983Species Human (Homo sapiens) [TaxId:9606] [311424] (8 PDB entries)
  8. 2231029Domain d5lexw_: 5lex W: [321540]
    Other proteins in same PDB: d5lexa_, d5lexb_, d5lexc_, d5lexd_, d5lexg_, d5lexh_, d5lexj_, d5lexk_, d5lexl_, d5lexn_, d5lexo_, d5lexp_, d5lexq_, d5lexr_, d5lexu_, d5lexv_, d5lexx_, d5lexy_, d5lexz_
    automated match to d3unfl_
    complexed with 1pe, k, mg

Details for d5lexw_

PDB Entry: 5lex (more details), 2.2 Å

PDB Description: native human 20s proteasome in mg-acetate at 2.2 angstrom
PDB Compounds: (W:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d5lexw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lexw_ d.153.1.0 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
gmgvivhiiekdkittrtlkarmd

SCOPe Domain Coordinates for d5lexw_:

Click to download the PDB-style file with coordinates for d5lexw_.
(The format of our PDB-style files is described here.)

Timeline for d5lexw_: