Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (8 PDB entries) |
Domain d5lexw_: 5lex W: [321540] Other proteins in same PDB: d5lexa_, d5lexb_, d5lexc_, d5lexd_, d5lexg_, d5lexh_, d5lexj_, d5lexk_, d5lexl_, d5lexn_, d5lexo_, d5lexp_, d5lexq_, d5lexr_, d5lexu_, d5lexv_, d5lexx_, d5lexy_, d5lexz_ automated match to d3unfl_ complexed with 1pe, k, mg |
PDB Entry: 5lex (more details), 2.2 Å
SCOPe Domain Sequences for d5lexw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lexw_ d.153.1.0 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]} simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs gmgvivhiiekdkittrtlkarmd
Timeline for d5lexw_: