Lineage for d5lf4o_ (5lf4 O:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990749Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries)
  8. 2990757Domain d5lf4o_: 5lf4 O: [321530]
    Other proteins in same PDB: d5lf4b_, d5lf4c_, d5lf4d_, d5lf4e_, d5lf4f_, d5lf4g_, d5lf4h_, d5lf4i_, d5lf4j_, d5lf4k_, d5lf4l_, d5lf4m_, d5lf4n_, d5lf4p_, d5lf4q_, d5lf4r_, d5lf4s_, d5lf4t_, d5lf4u_, d5lf4v_, d5lf4w_, d5lf4x_, d5lf4y_, d5lf4z_
    automated match to d1irub_
    complexed with 1pe, 6v7, cl, k, mg

Details for d5lf4o_

PDB Entry: 5lf4 (more details), 1.99 Å

PDB Description: human 20s proteasome complex with delanzomib at 2.0 angstrom
PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5lf4o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lf4o_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh
kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq
sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle
ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai

SCOPe Domain Coordinates for d5lf4o_:

Click to download the PDB-style file with coordinates for d5lf4o_.
(The format of our PDB-style files is described here.)

Timeline for d5lf4o_: