Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d5lf4j_: 5lf4 J: [321565] Other proteins in same PDB: d5lf4a_, d5lf4c_, d5lf4e_, d5lf4f_, d5lf4i_, d5lf4k_, d5lf4l_, d5lf4m_, d5lf4n_, d5lf4o_, d5lf4q_, d5lf4s_, d5lf4t_, d5lf4w_, d5lf4y_, d5lf4z_ automated match to d1iruk_ complexed with 1pe, 6v7, cl, k, mg |
PDB Entry: 5lf4 (more details), 1.99 Å
SCOPe Domain Sequences for d5lf4j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lf4j_ d.153.1.4 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv riidkngihdldnisf
Timeline for d5lf4j_: