Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5bxlv_: 5bxl V: [318506] Other proteins in same PDB: d5bxla_, d5bxlc1, d5bxlc2, d5bxld_, d5bxle_, d5bxlg_, d5bxli_, d5bxlj_, d5bxlk_, d5bxll_, d5bxln_, d5bxlo_, d5bxlq1, d5bxlq2, d5bxlr_, d5bxls_, d5bxlu_, d5bxlw_, d5bxlx_, d5bxly_, d5bxlz_ automated match to d4r17h_ complexed with cl, mg; mutant |
PDB Entry: 5bxl (more details), 2.8 Å
SCOPe Domain Sequences for d5bxlv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxlv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsasnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d5bxlv_:
View in 3D Domains from other chains: (mouse over for more information) d5bxla_, d5bxlb_, d5bxlc1, d5bxlc2, d5bxld_, d5bxle_, d5bxlf_, d5bxlg_, d5bxlh_, d5bxli_, d5bxlj_, d5bxlk_, d5bxll_, d5bxlm_, d5bxln_, d5bxlo_, d5bxlp_, d5bxlq1, d5bxlq2, d5bxlr_, d5bxls_, d5bxlt_, d5bxlu_, d5bxlw_, d5bxlx_, d5bxly_, d5bxlz_ |