Lineage for d5bxlm_ (5bxl M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994705Domain d5bxlm_: 5bxl M: [318424]
    Other proteins in same PDB: d5bxla_, d5bxlc1, d5bxlc2, d5bxld_, d5bxle_, d5bxlg_, d5bxli_, d5bxlj_, d5bxlk_, d5bxll_, d5bxln_, d5bxlo_, d5bxlq1, d5bxlq2, d5bxlr_, d5bxls_, d5bxlu_, d5bxlw_, d5bxlx_, d5bxly_, d5bxlz_
    automated match to d4qz7m_
    complexed with cl, mg; mutant

Details for d5bxlm_

PDB Entry: 5bxl (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g170a mutant
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5bxlm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxlm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgyg

SCOPe Domain Coordinates for d5bxlm_:

Click to download the PDB-style file with coordinates for d5bxlm_.
(The format of our PDB-style files is described here.)

Timeline for d5bxlm_: