Lineage for d5acba1 (5acb A:20-157)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718557Protein automated matches [227027] (3 species)
    not a true protein
  7. 2718587Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2718626Domain d5acba1: 5acb A:20-157 [318434]
    Other proteins in same PDB: d5acbc_, d5acbd_
    automated match to d2i53a1
    complexed with 5i1

Details for d5acba1

PDB Entry: 5acb (more details), 2.7 Å

PDB Description: crystal structure of the human cdk12-cyclink complex
PDB Compounds: (A:) cyclin-k

SCOPe Domain Sequences for d5acba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5acba1 a.74.1.1 (A:20-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh
rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee
vmvlerillqtikfdlqv

SCOPe Domain Coordinates for d5acba1:

Click to download the PDB-style file with coordinates for d5acba1.
(The format of our PDB-style files is described here.)

Timeline for d5acba1: